6KTOD

Crystal structure of human shld3-c-rev7-o-rev7-shld2 complex
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
48
structure length
32
Chain Sequence
SQVHIFWGAPIAADPWKKIQLLYSQHSLYLKD

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Molecular basis for assembly of the shieldin complex and its implications for NHEJ
doi rcsb
source organism Homo sapiens
structure length 32
sequence length 48
ec nomenclature
pdb deposition date 2019-08-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...