6KXHA

Alp1u_y247f mutant in complex with fluostatin c
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
293
structure length
293
Chain Sequence
GPVPSDRELARSLPGGFRSRHARVGGVRLHYVSGGHGEPLLLVPGWPQTWWAYRKVMPQLARRYHVIAVDLRGMGGSDKPAGGYDKKTMAADLHALVRGLGHRQVNVAGHDIGSMVAFAFAANHPEATRKVALLDTPHPDQSEYEMRILCRPGTGTTLWWWAFNQLQALPEQLMHGRMRHVIDWLYANSLADQSLVGDLDRDIYANAYNSPQAVRAGTRWFQACHQDITDQAGYGKLTMPVLGIGGNFTFEDLRNKLTAQATDVHMVRASKSVHYLPEEEPDVVAGALLDFFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative hydrolase
publication title Alp1U W187F/Y247F mutant in complex with fluostatin C and intermediate (soaked fluostatin C for 6 hours)
rcsb
source organism Streptomyces ambofaciens (strain atcc 23877 / 3486 / dsm 40053 / jcm 4204 / nbrc
total genus 114
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...