6KZSA

Crystal structure of cytochrome p450mel 107f1 in complex with heme and imidazole
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
396
structure length
396
Chain Sequence
TVRNCPFDYAHELEFDPQLRQLLTEEPVSRIRMAYGEGEAWLVTRYEDVRTVTTDRRFSRSAVLGRDFPRMTPEPIVQAESINLMDPPASSRLRGLVAKSFTPRRVEQMRGGTQRVVDRLLDEMEEEGSPADFVARVSAPLPLITICEALDIPEADRPWLRAHAMTMMNVGAAGKQDAVRAKAELRGYFQELTADRRRSPGEDLISTLATARDGDELLDDDELAVMAMVLLITGQDTTTYQLGNIAYTLLTRPDLLRSLRAEPQRLPRTLEELLRHIPFRKGVGIPRIALEDVELSGVLIKAGDVVHVSYLTANRDSAKFDRPDELDPDRPTIPHMTFGWGAHHCLGAPLATMELEVAFSTLLTRFPALRLDVPPEDVSWNTTSIWRYPLALPVTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome P-450
publication title Crystallization and X-ray analysis of cytochrome P450mel 107F1 with biaryl coupling reactivity
rcsb
source organism Streptomyces griseus
total genus 145
structure length 396
sequence length 396
ec nomenclature
pdb deposition date 2019-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...