6L3SA

Crystal structure of metallo-beta-lactamase imp-27 from morganella morganii
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
218
structure length
218
Chain Sequence
LPNLRVEKLEEGVYVHTSYEEVKGWGVVTKHGLVVLIGADAYLIDTPFTAKDTEKLVNWFVERGYKIKGTVSSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFDGVSYWLAKDKIEVFYPGPGHTQDNVVVWLPEKEILFGGCFVKPHGLGNLGDANLEAWPESAKILMEKYGKAKLVVSGHSETGDATHLKRTWEQAVKGLKESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IMP-27 metallo-beta-lactamase
publication title Crystal structure of the metallo-beta-lactamase IMP-27
rcsb
source organism Morganella morganii
total genus 69
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...