6L6GA

Crystal structure of semet_lpg0189
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
264
structure length
264
Chain Sequence
TDGLIFSPLPQNKNTVVRHYSNEQEMPNLSQMAQRTIDFPTQIVRVSGNLTGLELSCDDVENEIDQVFSKKISPNLFTYNTYVSCGYDVNDPEQHAINFSIQSYFDPLTDNAVDYLKSYLKEYNGYNLFNTTTLQIENAKGIIVSMNLNAGLKSNPDKTPFTLYRQDRNNFYFKSNFDVRKELISDIYQRFYSNDPDMILPFFDKWIFSYAGSVYYSILMASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKRNPNKHCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein Lpg0189
publication title Crystal structure of a hypothetical T2SS effector Lpg0189 from Legionella pneumophila reveals a novel protein fold.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
total genus 77
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-10-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...