6LBHC

Cryo-em structure of the mgte mg2+ channel under mg2+-free conditions
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
224
structure length
224
Chain Sequence
EVKLQESGVELVKPGASVKISCKASGYSFTGYNMNWVKQSHGKSLEWIGNISPYYGTSIYNQNFKGKATLTVDRSSSTAYMQLNSLTSEDSAVYYCARGESFSNYEGYYAMDYWGQGTSVIVSSAKTTAPSVYPLAPVCGDTSGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords Magnesium transporter MgtE
publication title The structure of MgtE in the absence of magnesium provides new insights into channel gating
rcsb
source organism Thermus thermophilus hb8
total genus 31
structure length 224
sequence length 224
chains with identical sequence E
ec nomenclature
pdb deposition date 2019-11-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...