6LCFA

Crystal structure of beta-l-arabinobiose binding protein - native
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
403
structure length
403
Chain Sequence
GIPAKGTDDGTEITLWTRSPLERQAKNVVEAYNKSHKNQVKLEIIPNDDMEGKVGGASQTDSLPDILAGDVVRIPYWASEGIFTDITKQIDGLDNKADLQQGHIEAGTVDGAEYTLPFITDVSVMVWNKNLYKEAGLDPEQGPKSIDQFVEQAKKVAALNKDGVAGSYLAGQSGGALVFDLFPSVWADGESVMNKDGSEATLDNDSMKGVLDAYKELANTTNGLGAGSKEETGATWTAPFANGKIGVMPYPNTSTTALFDAEKDGGFEVGVAPIPGTKEGKTSTFLGGDAMGISKDSKHVAQAWNFLYWLMQSDAQKEVFADQGDTASNIQTLKTAYKDADPRIQTINSVIIDGNGQTPKSPAFNEAFNAAGSPWQLLVQNAVWGSGDLKADNKAVTDVLSAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords ABC transporter substrate binding component
publication title Structural analysis of beta-L-arabinobiose binding protein in the metabolic pathway of hydroxyproline-rich glycoproteins in Bifidobacterium longum.
pubmed doi rcsb
source organism Bifidobacterium longum
total genus 157
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-11-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...