6LXJE

Crystal structure of human z2b3 fab in complex with influenza virus neuraminidase from a/anhui/1/2013 (h7n9)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
214
Chain Sequence
VQLVQSGAEVKKPGSSVKVSCKASGGPFSSYGFSWVRQAPGQGLEWMGGIIPVYGTTNYAQKFQGRVTITADESTSTAYMELSSLKSEDTAVYYCARDLQDTPMVDRIIGSYYYYNGLDVWGQGTTVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVTQTYICNVNHKPSNTKVDKKVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Neuraminidase
publication title Structure-Based Modification of an Anti-neuraminidase Human Antibody Restores Protection Efficacy against the Drifted Influenza Virus.
pubmed doi rcsb
source organism Influenza a virus (a/anhui/1-balf_rg44/2013(h7n9))
total genus 43
structure length 214
sequence length 230
chains with identical sequence H, J, M
ec nomenclature
pdb deposition date 2020-02-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...