6M6SA

Crystal structure of caenorhabditis elegans dicer-related helicase 3 (drh-3) c-terminal domain with 5'-ppp 12-mer dsrna
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
160
structure length
160
Chain Sequence
NKIYKLMCSNCSKEFCKSIYIKKVFSNYMVFDPSVWRFLHVESKRKVSKYLSEDNQPLSDIKCFHCKLDVGRAYKIRGTYLPQLSVKALTFVQESDYSSMTKAKWSDVEQDLFYISEAIEDDFRIMLNALSDTEENIEKKIVLDLDSRQHNKQLEMKRFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Dicer Related Helicase
publication title Crystal structure of Caenorhabditis elegans Dicer-related helicase 3 (DRH-3) C-terminal domain
rcsb
source organism Caenorhabditis elegans
total genus 44
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-03-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...