6MAIA

Crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from legionella pneumophila philadelphia 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
HQVIQLKILDSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIADPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEHFTVNPGDRIAQLVFIPVVQASFEVVNEFTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Deoxyuridine 5'-triphosphate nucleotidohydrolase
publication title Crystal structure of Deoxyuridine 5'-triphosphate nucleotidohydrolase from Legionella pneumophila Philadelphia 1
rcsb
source organism Legionella pneumophila subsp. pneumophila (strain philadelphia 1 / atcc 33152 /
total genus 22
structure length 137
sequence length 137
ec nomenclature ec 3.6.1.23: dUTP diphosphatase.
pdb deposition date 2018-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00692 dUTPase dUTPase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...