6MR3A

Crystal structure of the competence-damaged protein (cina) superfamily protein from streptococcus mutans
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
EKLYSRVLRFFGIGESHLVTLLHDLIAEQTDPTIAPYAKTGEVTIRLSTKAHRQKEADSKLDKLEKKIITIDNLADYFYGYGEENSLPQVVFDLLKEKGKTITAAESLTAGLFQARLADFAGASDIFKGGFITYSIEEKARMLGIPFEDLQLHGVVSAFTAEKMAERSRQLTQADLAISLTGVAGPDSLEGQPAGTVFIGLSSSKRTMAIKVLIGGRSRSDVRYIAVLHAFNLVRQTLLSHKNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Putative competence-damage inducible protein
publication title Crystal structure of the competence-damaged protein (CinA) superfamily protein from Streptococcus mutans
rcsb
source organism Streptococcus mutans serotype c (strain atcc 700610 / ua159)
total genus 76
structure length 245
sequence length 245
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2018-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00994 MoCF_biosynth Probable molybdopterin binding domain
A PF02464 CinA Competence-damaged protein
A PF18146 CinA_KH Damage-inducible protein CinA KH domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...