6MZXA8

Cryo-em structure of the ho bmc shell: icosahedral reconstruction (main population)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
201
structure length
201
Chain Sequence
LRTYIFLDALQPQLATFIGKTARGFLPVPGQASLWVEIAPGIAINRVTDAALKATKVQPAVQVVERAYGLLEVHHFDQGEVLAAGSTILDKLEVREEGRLKPQVMTHQIIRAVEAYQTQIINRNSQGMMILPGESLFILETQPAGYAVLAANEAEKAANVHLVNVTPYGAFGRLYLAGSEAEIDAAAEAAEAAIRSVSGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Ethanolamine utilization protein EutN/carboxysome structural
publication title The Plasticity of Molecular Interactions Governs Bacterial Microcompartment Shell Assembly.
pubmed doi rcsb
source organism Haliangium ochraceum (strain dsm 14365 / jcm 11303 / smp-2)
total genus 33
structure length 201
sequence length 201
chains with identical sequence A9
ec nomenclature
pdb deposition date 2018-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A8 PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...