6N4DA

The crystal structure of neuramindase from a/canine/il/11613/2015 (h3n2) influenza virus.
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
388
structure length
388
Chain Sequence
LEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDHSKCYQFALGQGTTLNNKHSNSTIHDRTSHRTLLMNELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCVTGDDRNATASFVYNGMLVDSIGSWSRNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIREGKIIHISPLSGSAQHIEECSCYPRYPNVRCVCRDNWKGSNRPVIDINMADYNINSSYVCSGLVGDTPRNDDSSSSSNCKDPNNERGNPGVKGWAFDNDNDVWMGRTISKDLRSGYETFKVIGGWTTANSKSQVNRQVIVDNNNWSGYSGIFSVEGKSCVNRCFYVELIRGGPQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Neuraminidase
publication title Assessment of Molecular, Antigenic, and Pathological Features of Canine Influenza A(H3N2) Viruses That Emerged in the United States.
pubmed doi rcsb
source organism Unidentified influenza virus
total genus 108
structure length 388
sequence length 388
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...