6NE8A

Solution structure of the thioredoxin-like domain of arabidopsis ncp (nuclear control of pep activity)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
145
structure length
145
Chain Sequence
HMDNYIRPIKDLTTAEWEEAVFKDISPLMVLVHNRYKRPKENEKFREELEKAIQVIWNCGLPSPRCVAVDAVVETDLVSALKVSVFPEIIFTKAGKILYREKGIRTADELSKIMAFFYYGAAKPPCLNGVVNSQEQIPLVDVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Thioredoxin-like fold domain-containing protein MRL7L, chlor
publication title NCP activates chloroplast transcription by controlling phytochrome-dependent dual nuclear and plastidial switches.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 36
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2018-12-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...