6NZ1A

Crystal structure of computationally designed protein xxa_gvdq
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
EDLKYSLERLREILERLEENPSEKQIVEAIRAIVENNAQIVEAIRAIVENNAQIVEILRAIIEALEAIGVDQKILEEMKKLLKDLKRSLERG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Design construct XXA_GVDQ
publication title Computational design of closely related proteins that adopt two well-defined but structurally divergent folds.
pubmed doi rcsb
source organism Synthetic construct
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2019-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...