6NZ7G

Crystal structure of broadly neutralizing influenza a antibody 429 b01 in complex with hemagglutinin hong kong 1968
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
227
structure length
221
Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFSFSTSVIHWVRQTPGKGLEWLAVISYDGSNKYYADSVQGRFTISRDNSNNTLYLQVNSLRPEDTAVYYCARGITVFGLLIINSAMDVWGQGTTVTVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Prolonged evolution of the memory B cell response induced by a replicating adenovirus-influenza H5 vaccine.
pubmed doi rcsb
molecule tags Immune system
source organism Influenza a virus (strain a/hong kong/1/1968 h3n2)
molecule keywords Hemagglutinin HA1 chain
total genus 29
structure length 221
sequence length 227
chains with identical sequence H
ec nomenclature
pdb deposition date 2019-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF07654 C1-set Immunoglobulin C1-set domain
G PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...