6OANB

Structure of dbp in complex with human neutralizing antibody 053054
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
250
structure length
229
Chain Sequence
VQLQESGPGLVKPSQTLSLTCNVSGDSINSGDYYWIWIRQPPGKGLEWIGNIYYSGTAYYNPSLKTRLIISIDTSTNQFSLKVTSVTAADTAIYYCARASTTVVSPWLDPWGQGTLVTVSYELTQPSSVAVAPGQTARIPCGGDNIESKGVHWYQQKPGQAPVLVVYDDHDRPSGIPERFSGSNSGNTATLTVSRVEAGDEADYYCQVWDTSSEHPVFGGGTKLTVLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Duffy binding surface protein region II
publication title Structural basis for neutralization of Plasmodium vivax by naturally acquired human antibodies that target DBP.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 49
structure length 229
sequence length 250
chains with identical sequence D
ec nomenclature
pdb deposition date 2019-03-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...