6OKBA

Prohead 2 of the phage t5
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
289
structure length
289
Chain Sequence
SSESYETIFSQRIIRDLQKELVVGALFEELPMSSKILTMLVEPDAGKATWVAASTYGTDTTTGEEVKGALKEIHFSTYKLAAKSFITDETEEDAIFSLLPLLRKRLIEAHAVSIEEAFMTGDGSGKPKGLLTLASEDSAKVVTEAKADGSVLVTAKTISKLRRKLGRHGLKLSKLVLIVSMDAYYDLLEDEEWQDVAQVGNDSVKLQGQVGRIYGLPVVVSEYFPAKANSAEFAVIVYKDNFVMPRQRAVTVERERQAGKQRDAYYVTQRVNLQRYFANGVVSGTYAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Major capsid protein
publication title Expansion of the bacteriophage T5 capsid: a highly dynamic process resolved at high-resolution
doi rcsb
total genus 45
structure length 289
sequence length 289
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2019-04-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...