6OORH

Structure of 1b1 bound to mouse cd1d
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
216
Chain Sequence
AQLVESGGVLVQPGRSLKLSCAASGFPFNNYDMAWVRQAPTKGLEWVASIRTGDIGTYYRDSVKGRFTVSRDNAKSTLYLQMDSLRSEDTATYYCVRPRSVYYGLLLRPYWFFDFWGPGTMVTVSSAQTTAPSVYPLAPGCTSSTVTLGCLVKGYFPEPVTVTWNSGASDVHTFPAVLQSGLYTLTSSVTSSTWPSQTVTCNVAHPASSTKVDKAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural basis of NKT cell inhibition using the T-cell receptor-blocking anti-CD1d antibody 1B1.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2019-04-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...