6ORDR9

Crystal structure of trna^ ala(ggc) u32-a38 bound to cognate 70s a site
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
37
structure length
37
Chain Sequence
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
pubmed doi rcsb
total genus 5
structure length 37
sequence length 37
chains with identical sequence Y9
ec nomenclature
pdb deposition date 2019-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R9 PF00444 Ribosomal_L36 Ribosomal protein L36
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...