6P1ZA

Bacteriophage phikz gp163.1 paar repeat protein in complex with the c-terminal part of the t4 gp5 beta-helical domain
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
92
structure length
92
Chain Sequence
GDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, hydrolase
molecule keywords Baseplate central spike complex protein gp5
publication title Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with the C-terminal part of the T4 gp5 beta-helical domain
rcsb
source organism Enterobacteria phage t4
total genus 1
structure length 92
sequence length 92
chains with identical sequence B, C, E, F, G
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2019-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06715 Gp5_C Gp5 C-terminal repeat (3 copies)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...