6P5UA

Structure of an enoyl-coa hydratase/aldolase isolated from a lignin-degrading consortium
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
243
structure length
239
Chain Sequence
GLTTVKVQFDEGIAWVSLNRPDKRNAMSPTLNREMLQVLEALEFDDRCGVVVLTGEGDSFSAGMDLKEYFREPALIKAQIRRAAGAWQWRKLRFYAKPTIAMVNGWCFGGAFTPLIACDLAVAADEATFGLSEINWGIIPAGNVTKAVSQVCGERAALYYIMSGEPFGGQKAREIGLVNESVPLAALRERTRELAKTLLGKNPTVLRQAKHALRRVEPMDWDLSEEYLAAKAEQTAAID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
publication title The structure of a prokaryotic feruloyl-CoA hydratase-lyase from a lignin-degrading consortium with high oligomerization stability under extreme pHs.
pubmed doi rcsb
source organism Uncultured organism
total genus 93
structure length 239
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2019-05-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...