6PAJA

Structure of the srrab histidine kinase dhp-ca domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
228
structure length
199
Chain Sequence
LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKRLNRLVNELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDRMDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Sensor protein SrrB
publication title The SrrAB two-component system regulates Staphylococcus aureus pathogenicity through redox sensitive cysteines
doi rcsb
source organism Staphylococcus aureus
total genus 72
structure length 199
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-06-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...