6PWBAO

Rigid body fitting of flagellin flab, and flagellar coiling proteins, fcpa and fcpb, into a 10 angstrom structure of the asymmetric flagellar filament purified from leptospira biflexa patoc wt cells resolved via subtomogram averaging
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
184
Chain Sequence
SGKSMADTEKELDDNISEVNKRLRLHTVLFKMLPHKTVLYKGKPSADGERCEAADKQEAQDNTCLHLEVFDFAKFKKMELFFEGSNNADPDPRKEQPRNLTKIRTYIYQNNFLLEDKVISVIADVAPNGEPAHNDKIELFYQHVGKYILSNVENPIRNNFKKQFYFKNLDYFDKLFTKIFDYND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Flagellin B1 (FlaB1)
publication title An asymmetric sheath controls flagellar supercoiling and motility in the leptospira spirochete.
pubmed doi rcsb
total genus 40
structure length 184
sequence length 221
chains with identical sequence BI, BJ, BK, BO, CD, CE, CF, CJ, CY, CZ, DA, DE, DT, DU, DV, DZ, EO, EP, EQ, EU, FJ, FK, FL, FP, GE, GF, GG, GK, GZ, HB, HF
ec nomenclature
pdb deposition date 2019-07-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...