6PZYC

Cryoem derived model of na-73 fab in complex with n9 shanghai2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
129
structure length
129
Chain Sequence
QVQLEESGPGLVKPSETLSLTCTVSGYTISSGYYWGWIRQPPGKGLEWIGCNNHRGSSYYNPSLKSRVIISVDTTKNKFSLKLSSVTAADTAVYYCARDPSFWSSTSRTSPYYYGMDVWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Neuraminidase
publication title Structural Basis of Protection against H7N9 Influenza Virus by Human Anti-N9 Neuraminidase Antibodies.
pubmed doi rcsb
source organism Influenza a virus (a/environment/shanghai/s1439/2013(h7n9))
total genus 24
structure length 129
sequence length 129
chains with identical sequence G, H, I
ec nomenclature
pdb deposition date 2019-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...