6Q01C

Tdp2 uba domain bound to ubiquitin at 0.85 angstroms resolution, crystal form 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
45
structure length
45
Chain Sequence
SNARRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords Ubiquitin
publication title Ubiquitin Stimulated Reversal of Topoisomerase 2 DNA Protein Crosslinks by TDP2
rcsb
source organism Homo sapiens
total genus 17
structure length 45
sequence length 45
chains with identical sequence D
ec nomenclature
pdb deposition date 2019-08-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...