6Q0B4

Poliovirus (type 1 mahoney), receptor-catalysed 135s particle incubated with anti-vp1 mab at rt for 1 hr
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
68
structure length
68
Chain Sequence
b'GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein VP1
publication title Cryo-EM structures reveal two distinct conformational states in a picornavirus cell entry intermediate.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 2
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2019-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...