6Q1IA

Gh5-4 broad specificity endoglucanase from clostrdium longisporum
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
348
structure length
348
Chain Sequence
SMRSASEIVQEMGVGWNLGNTLDAKITNLSYNTSPISFETGWGNPVTTKAMIDKIKNAGFKTIRIPTTWGEHLDGNNKLNEEWVKRVKEVVDYCIADDLYVILNTHHEGNWVIPTYAKESSVTPKLKTLWTQISEAFKDYDDHLIFETLNQPRLEGTPYEWTGGTSESRDVVNKYNAAALESIRKTGGNNLSRAVMMPTYAASGSSTTMNDFKVPDDKNVIASVHAYSPYFFAMDTSSNSVNTWGSSYDKYSLDVELDSYLNTFKSKGVPVVIGQFGSINKNNTSSRAELAEYYVTAAQKRGIPCVWWDNNYAETNKGETFGLLNRSTLNWYFSDIKDALIRGYKNVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoglucanase A
publication title GH5-4 broad specificity endoglucanasefrom Clostridum acetobutylicum
rcsb
source organism Clostridium longisporum
total genus 146
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2019-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00150 Cellulase Cellulase (glycosyl hydrolase family 5)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...