6Q2CA

Domain-swapped dimer of acanthamoeba castellanii cyp51
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
449
structure length
449
Chain Sequence
KGKLPPVVSSLIPFVGSGLSFAGGPLQYTTDAYKKYGDIFTMKVFGQRLTFLVGPDAHVPFFSQGDAELSQDEPYQFSVPIFGPNVVYGADLAHRNQQLKFIAASLSTKALQSYVPLIVKEAEDFFAKWDKSGTVDIRDALAELIILTASRCLMGKEIRENLFTEVAKLYQTLDEGLLPISVFFPYLPIPAHKRRDEARLAMVRMFKKIIDERRANPEVKHNDCLQVFMDARYRGEEQALNDEEITGLMIALLFAGQHTSSVTGSWTGLLLFEANNKKKFLPGVLEEQEEIRKEFGDELTMEALNKMDKLHRCVKEALRMYPPLLFVMRKVIKPFSYKDYYVPEGDTVFVSPALSMRVEEVFPNADQYNPERFVEEDKQAQKYRFVGFGAGRHGCMGENFAYLQIKTIWSVLLRNFDIELVGELPKPDYTAMVVGPAHPCLLRYTRKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Obtusifoliol 14alphademethylase
publication title Domain-Swap Dimerization of Acanthamoeba castellanii CYP51 and a Unique Mechanism of Inactivation by Isavuconazole.
pubmed doi rcsb
source organism Acanthamoeba castellanii str. neff
total genus 148
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00067 p450 Cytochrome P450
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...