6QPGM

Influenza a virus polymerase heterotrimer a/nt/60/1968(h3n2) in complex with nanobody nb8205
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGMVQPGGSLRLSCLASGFTFSNYAMTWVRQAPGKGPEWVSMVSNNGADTTYTDSVKGRFTISRDNAKNTLYLRMNNVKPEDSAVYYCAKRRYGGIWTGQPTDYDYLGQGTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Polymerase acidic protein
publication title Structures of influenza A virus RNA polymerase offer insight into viral genome replication
doi rcsb
source organism Influenza a virus (strain a/northern territory/60/1968 h3n2)
total genus 21
structure length 121
sequence length 121
chains with identical sequence N, O, P
ec nomenclature
pdb deposition date 2019-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...