6QRZA

Crystal structure of r2-like ligand-binding oxidase from sulfolobus acidocaldarius solved by 3d micro-crystal electron diffraction
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
274
Chain Sequence
IHKKFKATSVGYDWNTFPMKLYQIGKRLFWDPAKIDFSKDKEDWKKLSKDEKNYLLNIVSLFMAGEEAVAVDITPLISTMINEGRVEDVIYLEQFAFEEAKHAEAFRRFCDSLEINDDLTIFTTEYNPWYQKIFYEELPSVMWKLRVDPSPENLAVAVTTYNLYVEGVAAESGYKTFKHIFNSLNIMPGLSKTVNLIATDESRHIAYGTYLITRLIVENGESIYRKAIEQFNKLVGLPFGLTPDFTIENRKQLVNARLTVIERALKMTPEQVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ribonucleoside-diphosphate reductase
publication title Solving the first novel protein structure by 3D micro-crystal electron diffraction
doi rcsb
source organism Sulfolobus acidocaldarius dsm 639
total genus 92
structure length 274
sequence length 285
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 2019-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...