6QWNA

Protein peptide complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
338
structure length
335
Chain Sequence
LDLKFANNRLKRAYIALQAWKKAFYSDPFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALFHVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFPTVALSWPSLKFLDIRYNDFEGKLPPEIFDKDLDAIFLNNNRFESTIPETIGKSTASVVTFAHNKFSGCIPKTIGQMKNLNEIVFIGNNLSGCLPNEIGSLNNVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYNFFNGEAQSCSSQEKQFDDTSNCLQNRPNQKSAKECLPVVSRPVDCSKDKCAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Pollen-specific leucine-rich repeat extensin-like protein 1
publication title Structural basis for recognition of RALF peptides by LRX proteins during pollen tube growth
rcsb
source organism Arabidopsis thaliana
total genus 76
structure length 335
sequence length 338
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2019-03-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...