6QXPA

Protein peptide complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
345
structure length
342
Chain Sequence
PSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIFCAPSPSSPKTRVVAGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPLTFKHMKLLFELDLSNNRFVGKFPNVVLSLPSLKFLDLRYNEFEGSIPSKLFDKELDAIFLNHNRFMFGIPENMGNSPVSALVLADNDLGGCIPGSIGLMGKTLNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRFTGVIPSSICQLSNLENFTYSSNFFTGDAPRCVADNVVVNGSMNCIDGKEDQRSSKECSSPASRSVDCSKFGCNNFFSPLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Leucine-rich repeat extensin-like protein 2
publication title Structural basis for recognition of RALF peptides by LRX proteins during pollen tube growth.
pubmed doi rcsb
source organism Arabidopsis
total genus 90
structure length 342
sequence length 345
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2019-03-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...