6R5XA

8-bladed beta-propeller formed by four 2-bladed fragments
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
78
Chain Sequence
VWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords WD-40 repeat protein
publication title Structural diversity of oligomeric beta-propellers with different numbers of identical blades.
pubmed doi rcsb
source organism Nostoc punctiforme
total genus 18
structure length 78
sequence length 78
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2019-03-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...