6RCDA

Octamer c-domain p140 mycoplasma genitalium.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
98
Chain Sequence
ISFKPGNQIDFNRLFTLPVTELFDPNTMFVYDQYVPLLVNLPSGFDQASIRLKVISYSVENQTLGVRLEFKDPQTQQFIPVLNTGPQTVFQPFNQWAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords MgPa adhesin
publication title Alternative conformation of the C-domain of the P140 protein from Mycoplasma genitalium.
pubmed doi rcsb
source organism Mycoplasma genitalium
total genus 18
structure length 98
sequence length 101
chains with identical sequence B, C, D, E, F, G, X
ec nomenclature
pdb deposition date 2019-04-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...