6RFXA

Crystal structure of eis2 from mycobacterium abscessus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
409
structure length
404
Chain Sequence
ELTLRTIADEDDYESYMASAYSVFLRDPQKDEIEVNRKFTELDRMIGFHDGKKWVATTGAFSRHVVLPGGAVVPVAAVTAVTVSPTHRRRGLLTTMMRHQLADIRSRGESLAMLFASYGRFGYGVATESAELSGQVRELAFRPTVDLGDGTLEEVSAETFLASAPAIYDAVIPGLPGQMSRTPEWWASWTLDSEELQKESGKVRFVLHYESDGTASGFAIYRPKPGWGAGPNAELHVQEVLGTNPRSYARTWRYLLDMDLVRKIKYHGASVQEELRYLVANHPSLECVVSDAIQVRLVDIPRALAQRRYAADVDVVLEVTDDFLPENSGRYRLRGGLDHASCEITTDDADIALTVRDLGSVYMGGVSLQVLASAGLVTELRAGAVQRAATAFGWPVAPSAPDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords Eis2
publication title Crystal structure of the aminoglycosides N-acetyltransferase Eis2 from Mycobacterium abscessus.
pubmed doi rcsb
source organism Mycobacteroides abscessus
total genus 111
structure length 404
sequence length 409
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2019-04-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...