6RL2A

The crystal structure of abne, an arabino-oligosaccharide binding protein, in complex with arabinotetraose
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
415
structure length
415
Chain Sequence
KIELTFMFRGQPQEQTAYKNVVKKFEEKHPNVKVNIVVTSPDQYATKLRAAIAGRKIPDVFYFNPGELRAYVNSNVLLDITKYVENSKGVNLQDIWEKGVNKYRFDGEKVGQGNLYGLPKDLGPFALGYNKTMFEKAGIPLPDKDKPYTWQEFIDVCKKLTKDTNGDGKLDQWGTGLNATWTLQGFVWSNGADWIDESKTKVTVDDPKFIEALQFFADMQNKYKVTPSIAEAQTLDTYQRWLRGQLGFFPVGPWDLAAFDQQIKFEYDLIPWPAGSTGKPATWVGSLGIGVSSMTKHPKEAVELALYLSADPEGQKALVDQRVQLPNSVKVAEEWAKDPSIKPANKQEFLDIINDYGHSFPTEYTYNGEWYDEFYRNLQPVLDGKMSAEEYVKKAKPKMQKLLDQAIEQEKQASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Arabino-oligosaccharids-binding protein
publication title Carbohydrate-Binding Capability and Functional Conformational Changes of AbnE, an Arabino-oligosaccharide Binding Protein.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 148
structure length 415
sequence length 415
ec nomenclature
pdb deposition date 2019-05-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...