6RWLA

Sivrcm intasome
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
270
structure length
270
Chain Sequence
GFLDGIEKAQEEHEKYHNNWRAMAEDFQIPQVVAKEIVAQCPKCQVKGEAMHGQVDASPKTWQMDCTHLEGKVIIVAVHVASGYIEAEVLPAETGKETAHFLLKLAARWPVKHLHTDNGDNFTSSAVQAVCWWAQIEHTFGVPYNPQSQGVVESMNHQLKTIITQIRDQAEKIETAVQMAVLIHNFKRKGGIGGYSAGERIIDIIASDLQTTKLQNQISKIQNFRVYFREGRDQQWKGPATLIWKGEGAVVIQDGQDLKVVPRRKCKIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Pol protein
publication title Structural basis of second-generation HIV integrase inhibitor action and viral resistance
doi rcsb
source organism Simian immunodeficiency virus
total genus 62
structure length 270
sequence length 270
chains with identical sequence B, C, E, I, J, K, M
ec nomenclature
pdb deposition date 2019-06-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...