6S6FA

Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in apo form.
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
360
structure length
360
Chain Sequence
VAGQTALSTVGQEGAGLTYRGYDVRDLAAAAIFEEVAYLLLYGELPNKQQLDAYLKKLQGQRDLPQALKEVLERIPKDAHPMDVMRTGASVLGTLEPELSFDQQRDVADRLLAAFPAIMTYWYRFTHEGQRIDCNSDEPTIGGHFLALLHGKKPSELHVKVMNVSLILYAEHEFNASTFTARVCASTLSDLYSCVTGAIGSLRGPLHGGANEAAMELIERFSSPQEATAELLKMLERKDKIMGFGHAIYKDSDPRNEVIKGWSKQLADEVGDKVLFAVSEAIDKTMWEQKKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRTSGWTAHVFEQRANNRIIRPSAEYTGVEQRAFVPLEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Citrate synthase
publication title Crystal structure of 2-methylcitrate synthase (PrpC) from Pseudomonas aeruginosa in apo form.
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 140
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-07-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...