6S7JA

Native crystal structure of ergothioneine degrading enzyme ergothionase from treponema denticola
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
497
structure length
497
Chain Sequence
DALILTGKPLSLEDVYSVAYNNRQVKISDDAEERVKKARQILFDMAAEGKPVYGLNRGVGWNKDKEFDEDFFATYNRNLLNSHCLGVKPYHPDEQVRAILLLRLNKALTGHTGISAELLHHYRDFLNYGIHPRIPMRSSIGEGDITTLSHIGLAFIGEEDVSFNGEIMNSKKAMEKAGLKPAKLGPKDGLSIVSCNAQGEAMTAIVLKEIEDLVYMSNLIFCLSLEGLNGVVQSLREDVNAVRGIKGQIKAAEMCREFLKGSFLYDPDPERALQDPLSFRCAHSVNGTMYDAMDYVREQLLTTMNTTDDNPCIIIDEHSSFVSANFEITSLAIGVEMLATALSHLSKTSCYRMIKLADPSFTKLNRFLTPQDVKTIAFGTIQKTFTMLDTQNRGLANPSSMDFYSLAGTIEDHASNLPLACYKIFQMLDNIRYIIGIEAMHAAQAIDLRGNKKLGEGTKKAYSLIREVLPFYNEDRNISRDIETMYEFIKSKKLLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uncharacterized protein
publication title Structure and Mechanism of Ergothionase from Treponema denticola.
pubmed doi rcsb
source organism Treponema denticola sp33
total genus 202
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2019-07-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...