6SCYA

U34-trna thiolase ncsa from methanococcus maripaludis with its [4fe-4s] cluster
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
308
structure length
297
Chain Sequence
MITMKCRKCGKPSIYHQKHSGNNYCKECFIKETKRKVRKTLGRDVLKNNIKVAMGLSGGKDSLVMAYLLNEYYKQIPNSNLIAIMVNEGIEGYRTDGIDAAVKFCEEYGIEYKIVHFKDYLGTNLDEIVKLTMNPCSFCGVIRRKILNRVSIEEKCDFLAIGHNLDDVAQAVMMNYIEGDVKKLAFLGKSLKHPKFVKRIKPLEKIPEDEVLLLAEMLELKYHKSPCPYSCLSFRSEVSDITDNLEKNHPGSKYSIVRGYERLLEHIELECKICGDLSATEVCKVCSYLKNLGILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords [4Fe-4S]-dependent U34-ARNt thiolase
publication title The thiolation of uridine 34 in tRNA, which controls protein translation, depends on a [4Fe-4S] cluster in the archeum Methanococcus maripaludis.
rcsb
source organism Methanococcus maripaludis (strain s2 / ll)
total genus 81
structure length 297
sequence length 308
ec nomenclature
pdb deposition date 2019-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01171 ATP_bind_3 PP-loop family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...