6SD4A

Structure of the rbm3/collar region of the salmonella flagella ms-ring protein flif with 34-fold symmetry applied
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
208
structure length
151
Chain Sequence
NDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQTEEHYSPNGDASKATLRSRQLNISEQVPRSTQRNETSNYEVDRTIRHTKMNVGDIERLSVAVVVNYKLPLTADQMKQIEDLTREAMGFSDKRGDTLNVVNSPFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein
molecule keywords Flagellar M-ring protein
publication title Structure of the bacterial flagellar rotor MS-ring: a minimum inventory/maximum diversity system
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 29
structure length 151
sequence length 208
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h
ec nomenclature
pdb deposition date 2019-07-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...