6SICJ

Cryo-em structure of the type iii-b cmr-beta bound to cognate target rna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
475
structure length
475
Chain Sequence
EELLMSLKLKALYPLTGGYNRHSINPFYEELVRPTEIKGLWRWWNRVLFNTLAYSTKGKLYTYESIDRLFEDVFGSENKKSAVRLEVITDEGNDNRFELSYVELDKVIDCLRNYKRKVSLDFIDNTLIAEIEGSTKIPISFKSNLDIDKIIKDLVHNNKLLSFELLGFKSVEIDATKISDKKILKEILRDLITNYLEYFNIKQEVTFTLNIYLDKSREHKQNFEDKLKFALYSLLVFILLGGIGRKTSRGFGSLSIIDVKCYDNSICKKIEDLAKNFLKISSGNELKSKIESILDCIKNSCIDTLYIENNILSEIDPKKNVVYFINSDLFEVKRINDKEKVLANIYKAVSSEGCCIKSIITDKYVRKSFLIAFGGYRKVEKDKGLDIGFIKNYLCETCETVSSFNIVDFLLSEGSFMSDYILQYEHRNSLLRFKLISDNSNNSYLIGYILHSSYFKKIDIKYVRCILEKLTYCVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords CRISPR-associated protein, Cmr5 family
publication title Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas
doi rcsb
source organism Sulfolobus islandicus rey15a
total genus 106
structure length 475
sequence length 475
ec nomenclature
pdb deposition date 2019-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF03787 RAMPs RAMP superfamily
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...