6SKWAAA

Crystal structure of the legionella pneumophila type ii secretion system substrate ntte
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
263
Chain Sequence
DGLIFSPLPQNKNTVVRHYSNEQEMPNLSQMAQRTIDFPTQIVRVSGNLTGLELSCDDVENEIDQVFSKKISPNLFTYNTYVSCGYDVNDPEQHATNFSIQSYFDPLTDNAVDYLKSYLKEYNGYNLFNTTTLQIENAKGIIVSMNLNAGLKSNPDKTPFTLYRQDRNNFYFKSNFDVRKELISDIYQRFYSNDPDMILPFFDKWIFSYAGSVYYSILMASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKRNPNKHCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords NttE
publication title Structure, Dynamics and Cellular Insight Into Novel Substrates of theLegionella pneumophilaType II Secretion System.
pubmed doi rcsb
source organism Legionella pneumophila 130b
total genus 72
structure length 263
sequence length 263
chains with identical sequence BBB
ec nomenclature
pdb deposition date 2019-08-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...