6SMEA

The crystal structure of type ii dehydroquinase from propionibacterium acnes
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
MSKQILVLNGPNLGRLGRREPQIYGTTTHDDLAARLIEYGRELGLDVEVRQTDSEERMMGWIHQAADDRTPVVINPAAWSHYNIAIADALVQLVAPCIEVHISNIAAREEFRHHSVVSAHVTGTIAGLGLKGYELALSWLATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords 3-dehydroquinate dehydratase
publication title Biomacromolecular charge chirality detected using chiral plasmonic nanostructures
doi rcsb
source organism Cutibacterium acnes
total genus 51
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2019-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...