6STQA

Three dimensional structure of the giant reed (arundodonax) lectin (adl) complex with n,n'-diacetylchitobiose; 30 seconds soaking
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
165
Chain Sequence
AYECGKQGGGALCPNNKCCSRYGYCGFGPAYCGTGCQSGGCCPGKRCGDQANGETCPNNLCCSEDGYCGFGSEYCGAGCQGGPCRADKLCGQLCPDNLCCSQWGFCGLGVEFCGDGCQSGACCSMRCGRQADGAKCTNNYCCGASGYCGLGGDYCGAGCQSGPCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Arundo donax Lectin (ADL)
publication title Three-dimensional structure and properties of the giant reed (Arundo donax) lectin (ADL).
pubmed doi rcsb
total genus 43
structure length 165
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-09-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...