6STWA

Adenovirus 15 fiber knob protein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
190
structure length
190
Chain Sequence
DKLTLWTTPDPSPNCKIIEDKDSKLTLILTKCGSQILGSVSLLVVKGKFSNINNTTNPNEADKQITVKLLFDANGVLKQGSTMDSSYWNYRSDNSNLSQPYKKAVGFMPSKTAYPKQTKPTNKEISQAKNKIVSNVYLGGKIDQPCVIIISFNEEADSDYSIVFYFKWYKTYENVQFDSSSFNFSYIAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Fiber protein
publication title Adenovirus 29 Fiber Knob protein
rcsb
source organism Human adenovirus d serotype 15
total genus 43
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2019-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00541 Adeno_knob Adenoviral fibre protein (knob domain)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...