6SWHC

Crystal structure of the ternary complex between the type 1 pilus proteins fimc, fimi and fima from e. coli
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
134
structure length
112
Chain Sequence
AGSVDQTVQLGQVRTASLAQEGATSSAVGFNIAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSTIPFQARYFATGAATPGAANADATFKVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Chaperone protein FimC
publication title Comprehensive kinetic characterization of bacterial pilus rod assembly and assembly termination
rcsb
source organism Escherichia coli (strain k12)
total genus 14
structure length 112
sequence length 134
chains with identical sequence F
ec nomenclature
pdb deposition date 2019-09-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...