6SZCA

Nmr structure of repeat domain 13 of the fibrillar adhesin csha from streptococcus gordonii.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
QGGDPLVPIDETVEPTFEDGSKEKTIPGQGTYTIVPDGTVTFTPDKQFVGKPDPVTVKRVDKNGTPVTATYSPEFTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Surface-associated protein CshA
publication title The streptococcal multidomain fibrillar adhesin CshA has an elongated polymeric architecture.
pubmed doi rcsb
source organism Streptococcus gordonii (strain challis / atcc 35105 / bcrc 15272 / ch1 / dl1 / v
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2019-10-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...