6T48C

Bovine enterovirus f3 in complex with glutathione and a cysteinylglycine dipeptide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
243
structure length
243
Chain Sequence
GIPTLYTPGSGQFLTTDDFQTPCMLPKFQPTPVIDIPGEVKNFLEVVQVESLVEINNVESAEGVARYRIPLNVQDAMDGQIMALRVDPGIDGPMQSTLLGVFTRYYAQWSGSLDFTFMFCGTFMTTGKVIIAYTPPGGDQPTNRRQAMLGTHVVWDFGLQSSITLVVPWISSGHFRGTTLENTIYKYRYYEAGYITMWYQTNMVVPPNFPTTASILMFVAAQPNFSLRILKDRPDISQEGALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Glutathione facilitates enterovirus assembly by binding at a druggable pocket.
pubmed doi rcsb
total genus 43
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2019-10-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...